SLC22A14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59398

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC22A14 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC22A14(solute carrier family 22, member 14) The peptide sequence was selected from the N terminal of SLC22A14. Peptide sequence IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC22A14 Antibody - BSA Free

Western Blot: SLC22A14 Antibody [NBP1-59398]

Western Blot: SLC22A14 Antibody [NBP1-59398]

Western Blot: SLC22A14 Antibody [NBP1-59398] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Applications for SLC22A14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A14

SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 3. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

Alternate Names

MGC163415, OCTL2, OCTL4, ORCTL4, ORCTL-4, Organic cation transporter-like 4, organic cationic transporter-like 4, solute carrier family 22 (organic cation transporter), member 14, solute carrier family 22 member 14, solute carrier family 22, member 14

Gene Symbol

SLC22A14

UniProt

Q9Y267 (Human)

Additional SLC22A14 Products

Product Documents for SLC22A14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC22A14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A14 Antibody - BSA Free and earn rewards!

Have you used SLC22A14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies