SLC22A14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84263

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC22A14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC22A14. Peptide sequence: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC22A14 Antibody - BSA Free

Western Blot: SLC22A14 Antibody [NBP2-84263]

Western Blot: SLC22A14 Antibody [NBP2-84263]

Western Blot: SLC22A14 Antibody [NBP2-84263] - Host: Rabbit. Target Name: SLC22A14. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC22A14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A14

SLC22A14, also known as ORCTL4/OCTL2, is a member of the organic cation/anion/zwitterion transporter family. This transporter shares 36.8% protein sequence identity with SLC22A13/ORCTL3. It has been detected to a large extent at the transcriptional level in human tissues, including those of the kidney, colon, and small intestine. Additionally, a truncated form of SLC22A14 mRNA has been found abundantly in the testis.

Alternate Names

MGC163415, OCTL2, OCTL4, ORCTL4, ORCTL-4, Organic cation transporter-like 4, organic cationic transporter-like 4, solute carrier family 22 (organic cation transporter), member 14, solute carrier family 22 member 14, solute carrier family 22, member 14

Gene Symbol

SLC22A14

Additional SLC22A14 Products

Product Documents for SLC22A14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC22A14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A14 Antibody - BSA Free and earn rewards!

Have you used SLC22A14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies