SLC26A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60106

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC26A4(solute carrier family 26, member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC26A4 Antibody - BSA Free

Western Blot: SLC26A4 Antibody [NBP1-60106]

Western Blot: SLC26A4 Antibody [NBP1-60106]

Western Blot: SLC26A4 Antibody [NBP1-60106] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106]

Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106]

Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106] - Human placenta tissue at an antibody concentration of 5ug/ml.

Applications for SLC26A4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A4

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the S

Alternate Names

DFNB4, EVA, PDSTDH2B, pendrin, Sodium-independent chloride/iodide transporter, Solute carrier family 26 member 4, solute carrier family 26, member 4

Gene Symbol

SLC26A4

UniProt

Additional SLC26A4 Products

Product Documents for SLC26A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC26A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC26A4 Antibody - BSA Free

Customer Reviews for SLC26A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC26A4 Antibody - BSA Free and earn rewards!

Have you used SLC26A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC26A4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I used NBP1-60106 antibody and found bands around 30kDa like the WB result in the datasheet. The MW of this protein should be 86kDa, so I want to know what the 30kDa band is. I checked UniProt http://www.uniprot.org/uniprot/O43511, this protein does have a isoform, but the MW of isoform 2 is 39kDa. Would you please help on this?

    A: You are right that human SLC26A4 has two isoforms: isoform 1: 780 a.a. with mass (Da):85,723 and isoform 2: 349 a.a. mass (Da):39,267. But, according to "http://www.uniprot.org/uniprot/O43511#sequences", this protein contains 12 transmembrane domains and should be treated very carefully when preparing lysates. There are two suggestions I have come by for these kind of membrane proteins: (1), use 1% SDS (instead of 0.1%) in the RIPA buffer and/or (2) don't boil but use room temperature for 30 min after adding SDS sample buffer, before loading to the SDS-PAGE. The multiple bands around both isoforms 1 and 2 are likely to be derived from the complexes that were still associated with lipid moieties of the membranes. Furthermore, try to test with cell lines, rather than directly on the tissue samples, as cell lines will usually have less complexity on the isoform expression patterns.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...