SLC26A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88291

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC26A4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse SLC26A4. Peptide sequence: NVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC26A4 Antibody - BSA Free

Western Blot: SLC26A4 Antibody [NBP2-88291]

Western Blot: SLC26A4 Antibody [NBP2-88291]

Western Blot: SLC26A4 Antibody [NBP2-88291] - Host: Rabbit. Target Name: SLC26A4. Sample Tissue: Mouse Skeletal Muscle lysates. Antibody Dilution: 1ug/ml

Applications for SLC26A4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A4

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq]

Alternate Names

DFNB4, EVA, PDSTDH2B, pendrin, Sodium-independent chloride/iodide transporter, Solute carrier family 26 member 4, solute carrier family 26, member 4

Gene Symbol

SLC26A4

Additional SLC26A4 Products

Product Documents for SLC26A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC26A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC26A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC26A4 Antibody - BSA Free and earn rewards!

Have you used SLC26A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies