SLC26A6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25143

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC26A6 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein SLC26A6 using the following amino acid sequence: DATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC26A6 Antibody - BSA Free

SLC26A6 Antibody Immunocytochemistry/Immunofluorescence: SLC26A6 Antibody [NBP3-25143]

Immunocytochemistry/Immunofluorescence: SLC26A6 Antibody [NBP3-25143]

Staining of human cell line Hep-G2 shows localization to plasma membrane.

Applications for SLC26A6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A6

SLC26A6 belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Several alternatively spliced transcript variants of this gene, encoding distinct isoforms, have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Alternate Names

anion transporter 1, DKFZp586E1422, pendrin L1, Pendrin-L1, Pendrin-like protein 1, solute carrier family 26 member 6, solute carrier family 26, member 6, sulfate anion transporter

Gene Symbol

SLC26A6

Additional SLC26A6 Products

Product Documents for SLC26A6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC26A6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC26A6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC26A6 Antibody - BSA Free and earn rewards!

Have you used SLC26A6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies