SLC39A12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62528

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC39A12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter), member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC39A12 Antibody - BSA Free

Western Blot: SLC39A12 Antibody [NBP1-62528]

Western Blot: SLC39A12 Antibody [NBP1-62528]

Western Blot: SLC39A12 Antibody [NBP1-62528] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for SLC39A12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC39A12

SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Alternate Names

bA570F3.1, FLJ30499, LIV-1 subfamily of ZIP zinc transporter 8, LZT-Hs8, MGC43205, MGC51099, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, Solute carrier family 39 member 12, zinc transporter ZIP12, ZIP12, ZIP-12, Zrt- and Irt-like protein 12

Gene Symbol

SLC39A12

UniProt

Q504Y0-3 (Human)

Additional SLC39A12 Products

Product Documents for SLC39A12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC39A12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A12 Antibody - BSA Free and earn rewards!

Have you used SLC39A12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies