SLC4A10 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94675

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SLC4A10 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1). ALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC4A10 Antibody - Azide and BSA Free

SLC4A10 Antibody - Azide and BSA Free

Western Blot: SLC4A10 Antibody [NBP2-94675] -

Western Blot: SLC4A10 Antibody [NBP2-94675] -analysis of lysates from Mouse eye using SLC4A10 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Applications for SLC4A10 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC4A10

SLC4A10 is an Na(+)-dependent Cl-/HCO3- exchanger (Jacobs et al., 2008 (PubMed 18165320)).(supplied by OMIM)

Alternate Names

sodium bicarbonate cotransporter-like, member 10, sodium bicarbonate transporter-like, member 10, sodium-driven chloride bicarbonate exchanger, Solute carrier family 4 member 10, solute carrier family 4, sodium bicarbonate transporter, member 10

Gene Symbol

SLC4A10

Additional SLC4A10 Products

Product Documents for SLC4A10 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC4A10 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SLC4A10 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC4A10 Antibody - Azide and BSA Free and earn rewards!

Have you used SLC4A10 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies