SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

Novus Biologicals | Catalog # NBP3-33387

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6F7V1
View all SLC6A2/NET Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2/NET/Noradrenaline transporter.1).

Sequence:
MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1) [NBP3-33387] -

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1) [NBP3-33387] - Western blot analysis of various lysates, using SLC6A2/NET/Noradrenaline transporter Rabbit mAb at 1:16000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC6A2/NET

Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).

Long Name

Norepinephrine Transporter

Alternate Names

NAT1, Noradrenalin Transporter, Norepinephrine Transporter

Gene Symbol

SLC6A2

Additional SLC6A2/NET Products

Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)

There are currently no reviews for this product. Be the first to review SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1) and earn rewards!

Have you used SLC6A2/NET/Noradrenaline transporter Antibody (6F7V1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies