SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60120

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC6A2(solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2) The peptide sequence was selected from the middle region of SLC6A2. Peptide sequence STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Adult Placenta
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Tissue:Human Fetal Lung.
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] -

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Fetal Heart.

Applications for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC6A2/NET

The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis (Kim et al., 2006 [PubMed 17146058]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Norepinephrine Transporter

Alternate Names

NAT1, Noradrenalin Transporter, Norepinephrine Transporter

Gene Symbol

SLC6A2

UniProt

Additional SLC6A2/NET Products

Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free and earn rewards!

Have you used SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...