SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-60120
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SLC6A2(solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2) The peptide sequence was selected from the middle region of SLC6A2.
Peptide sequence STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/mlWestern Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Adult PlacentaWestern Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Tissue:Human Fetal Lung.Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] -
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Fetal Heart.Applications for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC6A2/NET
Long Name
Norepinephrine Transporter
Alternate Names
NAT1, Noradrenalin Transporter, Norepinephrine Transporter
Gene Symbol
SLC6A2
UniProt
Additional SLC6A2/NET Products
Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free and earn rewards!
Have you used SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...