SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-85762
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2/NET/Noradrenaline transporter. Peptide sequence: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Researcher: Lesie Sheiton, Physiological Sciences GIDP, University of Arizona. Application: Western blotting. Species + Tissue/Cell type: 1: 50ug human placenta lysate, 2: 50ug human placenta lysate, 3: 50ug sheep placenta lysate, 4: 50ug sheep placenta lysate. Primary antibody dilution: 1:1000. Secondary antibody: Anti-rabbit HRP. Secondary antibody dilution: 1:20,000Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysateWestern Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Host: Rabbit. Target Name: SLC6A2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/mlWestern Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Host: Rat. Target Name: SLC6A2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/mlApplications for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC6A2/NET
Long Name
Norepinephrine Transporter
Alternate Names
NAT1, Noradrenalin Transporter, Norepinephrine Transporter
Gene Symbol
SLC6A2
Additional SLC6A2/NET Products
Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free and earn rewards!
Have you used SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...