SLC6A3/DAT1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-46649PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A3.

Source: E. coli

Amino Acid Sequence: LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46649.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-46649PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLC6A3/DAT1

The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse (Kish et al., 2001; Zhu et al., 2000; Zhu et al., 1999). Levels of DAT protein expression are altered by chronic drug administration (Wilson et al., 1996).

Long Name

Dopamine Transporter

Alternate Names

DAT1, SLC6A3, VNTR

Gene Symbol

SLC6A3

Additional SLC6A3/DAT1 Products

Product Documents for SLC6A3/DAT1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC6A3/DAT1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SLC6A3/DAT1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review SLC6A3/DAT1 Recombinant Protein Antigen and earn rewards!

Have you used SLC6A3/DAT1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SLC6A3/DAT1 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Could you kindly provide published references for Western blot in detection of Dopamine transporter in human brain tissue with your antibody/antibodies?

    A: Catalog numbers NBP2-22164, NB300-254 and NB100-65459 are well characterized DAT1 antibodies that have been referenced. If you refer to our website we have links to the PMID listing for each reference on the individual datasheets.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...