SLC7A9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92409

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC7A9 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows strong positivity in apical membrane in cells in proximal tubules.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409]

Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
SLC7A9 Antibody - BSA Free Immunohistochemistry: SLC7A9 Antibody - BSA Free [NBP1-92409]

Immunohistochemistry: SLC7A9 Antibody - BSA Free [NBP1-92409]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
SLC7A9 Antibody - BSA Free Immunohistochemistry: SLC7A9 Antibody - BSA Free [NBP1-92409]

Immunohistochemistry: SLC7A9 Antibody - BSA Free [NBP1-92409]

Analysis in human duodenum and pancreas tissues using NBP1-92409 antibody. Corresponding SLC7A9 RNA-seq data are presented for the same tissues.

Applications for SLC7A9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC7A9

The SLC7A9 gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in t

Long Name

Solute Carrier Family 7 Member 9

Alternate Names

b(0,+)AT, BAT1, CSNU3

Gene Symbol

SLC7A9

Additional SLC7A9 Products

Product Documents for SLC7A9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC7A9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC7A9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC7A9 Antibody - BSA Free and earn rewards!

Have you used SLC7A9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...