SLC9A7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79719

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is Slc9a7. Peptide sequence SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC9A7 Antibody - BSA Free

Western Blot: SLC9A7 Antibody [NBP1-79719]

Western Blot: SLC9A7 Antibody [NBP1-79719]

Western Blot: SLC9A7 Antibody [NBP1-79719] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.

Applications for SLC9A7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC9A7

Na+/H+ exchangers (NHE) of mammalian cells are plasma membrane intrinsic proteins mediating exchange of N+ and H+ ions in various tissues. The NHE catalyzes the electroneural transport of extracellular Na+ for intracellular H+. They play a major role in regulation of intracellular pH (pHi) in addition to trans-cellular absorption of Na+, cell volume regulation and possibly in cell proliferation. These primary functions of the Na+/H+ exchanger have been related to many pathophysiological states, include hypertension, organ growth and hypertrophy, regression of cancer and renal intestinal disorders. At least 7 NHE isoforms (NHE1-7) have been cloned so far. They are all similar in their primary structure and predicted to have 10-12 transmembrane domains. The C-terminal domain of NHEs are predicted to be intracellular. NHE7 (human 725 aa, chromosome Xp11.4) is ubiquitously expressed, and predominantly localizes to the trans-golgi network. NHE7 mediates the influx of Na+ or K+ in exchange for H+. It is ~70% related to NHE6 but relatively less (~25%) homologous with other NHEs.

Long Name

Sodium/hydrogen exchanger 7

Alternate Names

NHE-7, NHE7

Gene Symbol

SLC9A7

Additional SLC9A7 Products

Product Documents for SLC9A7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC9A7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC9A7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC9A7 Antibody - BSA Free and earn rewards!

Have you used SLC9A7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...