SLCO4A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85772

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLCO4A1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLCO4A1. Peptide sequence: WWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLCO4A1 Antibody - BSA Free

Western Blot: SLCO4A1 Antibody [NBP2-85772]

Western Blot: SLCO4A1 Antibody [NBP2-85772]

Western Blot: SLCO4A1 Antibody [NBP2-85772] - Host: Rabbit. Target Name: SLCO4A1. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SLCO4A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLCO4A1

SLCO4A1 mediates the Na(+)-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate

Alternate Names

colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1

Gene Symbol

SLCO4A1

Additional SLCO4A1 Products

Product Documents for SLCO4A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLCO4A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLCO4A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLCO4A1 Antibody - BSA Free and earn rewards!

Have you used SLCO4A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies