SLITRK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82346

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLITRK2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLITRK2. Peptide sequence: YNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLITRK2 Antibody - BSA Free

Western Blot: SLITRK2 Antibody [NBP2-82346]

Western Blot: SLITRK2 Antibody [NBP2-82346]

Western Blot: SLITRK2 Antibody [NBP2-82346] - Host: Rabbit. Target Name: SLITRK2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SLITRK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLITRK2

SLITRK2 (Slit and Trk-like family member 2) is a transmembrane protein that is expressed in multiple regions of the brain, particularly the cerebral cortex and hippocampus. It can suppress neurite outgrowth and promote the formation of excitatory and inhibitory presynaptic structures. The synaptogenic function is dependent on the interaction of SLITRK2 with select isoforms of PTP-sigma. In humans, mutations of SLITRK6 are associated with bipolar disorder and schizophrenia.

Long Name

SLIT and NTRK-like Family, Member 2

Alternate Names

CXorf2, SLITL1

Gene Symbol

SLITRK2

Additional SLITRK2 Products

Product Documents for SLITRK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLITRK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLITRK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLITRK2 Antibody - BSA Free and earn rewards!

Have you used SLITRK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies