SLP-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79903

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLP-2 Antibody - BSA Free

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.
Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Human 293T, Antibody Dilution: 1.0 ug/ml STOML2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Applications for SLP-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLP-2

STOML2 is similar in sequence to stomatin. It is a 356 amino acid protein with a calculated molecular mass of 38.5 kDa. STOML2 has 3 potential initiator sites, all sharing the same open reading frame. The STOML2 protein contains the cognate stomatin family consensus sequence, but it lacks the characteristic N-terminal hydrophobic domain and palmitoylation consensus sequence. STOML2 shares greatest sequence homology with stomatin and SLP1 in a region predicted to contain beta sheet and alpha helix structures. Northern blot analysis detected a 1.5 kb STOML2 transcript in all tissues examined, with highest levels in heart, liver, and pancreas. Western blot analysis detected STOML2 at apparent molecular masses of 45.5 kDa or 44.6 kDa in all human and mammalian cell lines and tissues examined, including red blood cells. Some cells also showed a faint band at about 34.3 kDa, which may represent translation from an alternate initiation site.

Alternate Names

EPB72-like protein 2, HSPC108, SLP2, SLP-2stomatin-like protein 2, stomatin (EPB72)-like 2, stomatin-like 2

Gene Symbol

STOML2

Additional SLP-2 Products

Product Documents for SLP-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLP-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLP-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLP-2 Antibody - BSA Free and earn rewards!

Have you used SLP-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...