SMARCA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57145

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SMARCA6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HELLS(helicase, lymphoid-specific) The peptide sequence was selected from the middle region of HELLS. Peptide sequence QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SMARCA6 Antibody - BSA Free

Western Blot: SMARCA6 Antibody [NBP1-57145]

Western Blot: SMARCA6 Antibody [NBP1-57145]

Western Blot: SMARCA6 Antibody [NBP1-57145] - MCF7, Antibody Dilution: 1.0 ug/ml HELLS is supported by BioGPS gene expression data to be expressed in MCF7.
Western Blot: SMARCA6 Antibody [NBP1-57145]

Western Blot: SMARCA6 Antibody [NBP1-57145]

Western Blot: SMARCA6 Antibody [NBP1-57145] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for SMARCA6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMARCA6

HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.This gene encodes a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Alternate Names

EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6

Gene Symbol

HELLS

UniProt

Q9NRZ9 (Human)

Additional SMARCA6 Products

Product Documents for SMARCA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMARCA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMARCA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMARCA6 Antibody - BSA Free and earn rewards!

Have you used SMARCA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies