SMC1L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85776

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SMC1L2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMC1L2. Peptide sequence: RKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SMC1L2 Antibody - BSA Free

Western Blot: SMC1L2 Antibody [NBP2-85776]

Western Blot: SMC1L2 Antibody [NBP2-85776]

Western Blot: SMC1L2 Antibody [NBP2-85776] - Host: Rabbit. Target Name: SMC1B. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SMC1L2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMC1L2

SMC1L2 - SMC1 structural maintenance of chromosomes 1-like 2 (yeast)

Alternate Names

bK268H5, bK268H5.5, FLJ43748, mitosis-specific chromosome segregation protein like protein beta, SMC protein 1B, SMC1 (structural maintenance of chromosomes 1, yeast)-like 1, SMC1 structural maintenance of chromosomes 1-like 2, SMC1 structural maintenance of chromosomes 1-like 2 (yeast), SMC-1B, SMC1BETA, SMC-1-beta, SMC1L2, structural maintenance of chromosomes 1B, structural maintenance of chromosomes protein 1B

Gene Symbol

SMC1B

Additional SMC1L2 Products

Product Documents for SMC1L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMC1L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC1L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC1L2 Antibody - BSA Free and earn rewards!

Have you used SMC1L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies