SMC6L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10033

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMC6L1 (NP_001135758.1). Peptide sequence MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIES

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SMC6L1 Antibody - BSA Free

Western Blot: SMC6L1 Antibody [NBP3-10033]

Western Blot: SMC6L1 Antibody [NBP3-10033]

Western Blot: SMC6L1 Antibody [NBP3-10033] - Western blot analysis of SMC6L1 in Human Neurofibroma Tumor lysates. Antibody dilution at 1ug/ml

Applications for SMC6L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMC6L1

SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.

Alternate Names

FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6

Gene Symbol

SMC6

Additional SMC6L1 Products

Product Documents for SMC6L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMC6L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC6L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC6L1 Antibody - BSA Free and earn rewards!

Have you used SMC6L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...