SNAP43 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80296

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNAP43 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human SNAPC1. Peptide sequence GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVIT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SNAP43 Antibody - BSA Free

Western Blot: SNAP43 Antibody [NBP1-80296]

Western Blot: SNAP43 Antibody [NBP1-80296]

Western Blot: SNAP43 Antibody [NBP1-80296] - Transfected 293T cell lysate, concentration 1.25ug/ml.

Applications for SNAP43 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNAP43

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box

Alternate Names

Proximal sequence element-binding transcription factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, small nuclear RNA activating complex, polypeptide 1, 43kD, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, SNAP43SNAPc 43 kDa subunit, SNAPc subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1

Gene Symbol

SNAPC1

UniProt

NP_003073 (Human)

Additional SNAP43 Products

Product Documents for SNAP43 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNAP43 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNAP43 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNAP43 Antibody - BSA Free and earn rewards!

Have you used SNAP43 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies