SNX26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09643

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SNX26 (NP_001166101.1). Peptide sequence PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SNX26 Antibody - BSA Free

Western Blot: SNX26 Antibody [NBP3-09643]

Western Blot: SNX26 Antibody [NBP3-09643]

Western Blot: SNX26 Antibody [NBP3-09643] - Western blot analysis of SNX26 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for SNX26 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX26

SNX26 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The specific function of this protein has not been elucidated. Alternative splice variants have been described but their full length nature has not been determined. SNX26 may be involved in several stages of intracellular trafficking. It could play an important role in the regulation of glucose transport by insulin. It may act as a downstream effector of RHOQ/TC10 in the regulation of insulin-stimulated glucose transport.

Alternate Names

FLJ39019, neurite outgrowth multiadaptor RhoGAP protein, NOMA-GAP, Rho GTPase activating protein 33, rho GTPase-activating protein 33, Rho-type GTPase-activating protein 33, sorting nexin 26, Sorting nexin-26, Tc10/CDC42 GTPase-activating protein, TCGAPSNX26

Gene Symbol

ARHGAP33

Additional SNX26 Products

Product Documents for SNX26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX26 Antibody - BSA Free and earn rewards!

Have you used SNX26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...