SNX27 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86817

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX27. Peptide sequence: EEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SNX27 Antibody - BSA Free

Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817] - Host: Rabbit. Target Name: SNX27. Sample Type: Human Jurkat. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/ml. Peptide Concentration: 2.0 ug/ml. Lysate Quantity: 25 ug/lane
Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817] - Host: Rabbit. Target Name: SNX27. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlSNX27 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817]

Western Blot: SNX27 Antibody [NBP2-86817] - Host: Rabbit. Target: SNX27. Positive control (+): Human Placenta (PL). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 1ug/ml

Applications for SNX27 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX27

The SNX27 gene encodes a member of the sorting nexin family, a diverse group of cytoplasmic and membrane-associated proteins involved in endocytosis of plasma membrane receptors and protein trafficking through these compartments. All members of this protein fa

Alternate Names

KIAA0488MGC126873, methamphetamine-responsive transcript 1, MGC126871, MGC20471, MRT1, MY014, sorting nexin family member 27, sorting nexin-27

Gene Symbol

SNX27

Additional SNX27 Products

Product Documents for SNX27 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX27 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX27 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX27 Antibody - BSA Free and earn rewards!

Have you used SNX27 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...