Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83574

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Sodium Calcium Exchanger 1/NCX1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Sodium Calcium Exchanger 1/NCX1. Peptide sequence: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-83574]

Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-83574]

Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-83574] - Host: Rabbit. Target Name: SLC8A1. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sodium Calcium Exchanger 1/NCX1

NCX1 (Na(+)/Ca(2+) exchanger (NCX-1)) expression and protein levels vary during heart development and in response to changes in thyroid hormone levels (1). The expression of the NCX1 gene is two-fold higher in the hearts of fetal versus adult mice. In addition, NCX1 mRNA and protein levels were upregulated in hypothyroidic hearts. In hyperthyroidic hearts this response was reversed, however.

Alternate Names

NCX1, Slc8a1

Gene Symbol

SLC8A1

Additional Sodium Calcium Exchanger 1/NCX1 Products

Product Documents for Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free and earn rewards!

Have you used Sodium Calcium Exchanger 1/NCX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies