Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84601

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Sodium Potassium ATPase Alpha 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Sodium Potassium ATPase Alpha 1. Peptide sequence: GRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-84601]

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-84601]

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-84601] - Host: Rabbit. Target Name: AT1A1. Sample Type: HCT116 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 1

Sodium Potassium ATPase is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. The Sodium Potassium ATPase enzyme is comprised of an alpha and beta subunit. The alpha-polypeptide (Sodium Potassium ATPase Alpha 1) has been shown to be the catalytically active subunit, whereas the Beta-polypeptide appears to be necessary for the assembly and transport of the sodium pump to the plasma membrane. Sodium Potassium ATPase alpha-1 subunit, in the brain, is expressed in both neuronal and non-neuronal cells.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-1

Alternate Names

ATP1A1, EC 7.2.2.13

Gene Symbol

ATP1A1

Additional Sodium Potassium ATPase Alpha 1 Products

Product Documents for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 1 Antibody - BSA Free and earn rewards!

Have you used Sodium Potassium ATPase Alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking forward to pick up a plasma membrane marker. I have gastric cancer cell line and I am preparing PM out of that. To just check the quality of prep, I need a plasma membrane marker.

    A:

    Our sodium potassium ATPase and plasma membrane products may be of use to you. Please contact us at technical@novusbio.com with any additional questions.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies