Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Novus Biologicals | Catalog # NBP3-15737

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5T3O4 expressed in HEK293
View all Sodium Potassium ATPase Alpha 2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 2 (P50993). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737]

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737]

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737] - Western blot analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 2 antibody (NBP3-15737) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 2

The ubiquitously expressed sodium/potassium-ATPase exists as a oligomeric plasma membrane complex that couples the hydrolysis of one molecule of ATP to the importation of three Na+ ions and two K+ ions against their respective electrochemical gradients. As a member of the P-type family of ion motifs, sodium/potassium-ATPase plays a critical role in maintaining cellular volume, resting membrane potential and Na+-coupled solute transport. Multiple isoforms of three subunits, alpha, beta and gamma, comprise to form the sodium/potassium-ATPase oligomer. The 113 kDa alpha subunit contains the binding sites for ATP and the cations. With a molecular weight between 40 and 60 kDa, the glycosylated beta subunit ensures correct folding and membrane insertion of the alpha subunits. The small 6 kDa gamma subunit co-localizes with the alpha subunit in nephron segments, where it increases the affinity of sodium/potassium-ATPase for ATP. The beta subunit, but not the gamma subunit, is essential for normal activity of sodium/potassium-ATPase.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-2

Alternate Names

ATP1A2, KIAA0778

Gene Symbol

ATP1A2

Additional Sodium Potassium ATPase Alpha 2 Products

Product Documents for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) and earn rewards!

Have you used Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies