Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94614

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2). MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

Western Blot: Sodium Potassium ATPase Alpha 4 AntibodyAzide and BSA Free [NBP2-94614]

Western Blot: Sodium Potassium ATPase Alpha 4 AntibodyAzide and BSA Free [NBP2-94614]

Western Blot: Sodium Potassium ATPase Alpha 4 Antibody [NBP2-94614] - Analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1S.

Applications for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:200-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 4

The protein encoded by the Sodium Potassium ATPase Alpha 4 gene belongs to the family of P-type cation transport ATPases, and to the subfamily ofNa+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining theelectrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential forosmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electricalexcitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and asmaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This geneencodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have beenidentified. (provided by RefSeq)

Long Name

Sodium/potassium-transporting ATPase subunit alpha-4

Alternate Names

ATP1A4, ATP1AL2

Gene Symbol

ATP1A4

Additional Sodium Potassium ATPase Alpha 4 Products

Product Documents for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free and earn rewards!

Have you used Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...