Somatostatin R4/SSTR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88334

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Somatostatin R4/SSTR4. Peptide sequence: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Somatostatin R4/SSTR4 Antibody - BSA Free

Western Blot: Somatostatin R4/SSTR4 Antibody [NBP2-88334]

Western Blot: Somatostatin R4/SSTR4 Antibody [NBP2-88334]

Western Blot: Somatostatin R4/SSTR4 Antibody [NBP2-88334] - WB Suggested Anti-SSTR4 Antibody. Titration: 1.25 ug/ml. Positive Control: Jurkat Whole Cell

Applications for Somatostatin R4/SSTR4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Somatostatin R4/SSTR4

SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.

Long Name

Somatostatin Receptor Type 4

Alternate Names

SomatostatinR4, SS4R, SSTR4

Gene Symbol

SSTR4

Additional Somatostatin R4/SSTR4 Products

Product Documents for Somatostatin R4/SSTR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Somatostatin R4/SSTR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Somatostatin R4/SSTR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Somatostatin R4/SSTR4 Antibody - BSA Free and earn rewards!

Have you used Somatostatin R4/SSTR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...