Sorting Nexin 31 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10155

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Sorting Nexin 31 (NP_079988.3). Peptide sequence QIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Sorting Nexin 31 Antibody - BSA Free

Western Blot: Sorting Nexin 31 Antibody [NBP3-10155]

Western Blot: Sorting Nexin 31 Antibody [NBP3-10155]

Western Blot: Sorting Nexin 31 Antibody [NBP3-10155] - Western blot analysis of Sorting Nexin 31 in Mouse Brain lysates. Antibody dilution at 1ug/ml

Applications for Sorting Nexin 31 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sorting Nexin 31

SNX31, also known as Sorting nexin 31, has 2 isoforms, a 440 amino acid long isoform that is 51 kDa and a short 341 amino acid isoform that is 39 kDa, and may be involved in protein trafficking. The protein is being studied for its involvement in lupus erythematosus. This protein is being linked to cell communication and protein transport biological processes.

Alternate Names

MGC39715, sorting nexin 31, sorting nexin-31

Gene Symbol

SNX31

Additional Sorting Nexin 31 Products

Product Documents for Sorting Nexin 31 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sorting Nexin 31 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sorting Nexin 31 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sorting Nexin 31 Antibody - BSA Free and earn rewards!

Have you used Sorting Nexin 31 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...