SOX7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80374

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SOX7 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human SOX7. Peptide sequence LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SOX7 Antibody - BSA Free

Western Blot: SOX7 Antibody [NBP1-80374]

Western Blot: SOX7 Antibody [NBP1-80374]

Western Blot: SOX7 Antibody [NBP1-80374] - Host: Rabbit. Target: SOX7. Positive control (+): Human Brain (BR). Negative control (-): HepG2 Cell Lysate (HG). Antibody concentration: 1ug/ml
Western Blot: SOX7 Antibody [NBP1-80374]

Western Blot: SOX7 Antibody [NBP1-80374]

Western Blot: SOX7 Antibody [NBP1-80374] - Human Fetal Stomach Cell Lysate, concentration 1 ug/ml.

Applications for SOX7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOX7

SOX7 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway. [provided by RefSeq]

Long Name

Transcription Factor SOX7

Alternate Names

MGC10895, SOX7 transcription factor, SRY (sex determining region Y)-box 7, transcription factor SOX-7

Gene Symbol

SOX7

UniProt

NP_113627 (Human)

Additional SOX7 Products

Product Documents for SOX7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SOX7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Early Endodermal Lineage Markers

Customer Reviews for SOX7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SOX7 Antibody - BSA Free and earn rewards!

Have you used SOX7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies