SPACA1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38506
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0013.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SPACA1 Antibody - BSA Free
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Liver shows no positivity in hepatocytes as expected.![Immunohistochemistry: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-NBP2-38506-img0001.jpg "Immunohistochemistry: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0002.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human endometrium shows low expression as expected.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0003.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows high expression.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0004.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0005.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0006.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0007.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human kidney.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0008.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human liver.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0009.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Analysis in human testis and liver tissues using NBP2-38506 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0010.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0011.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0012.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Kidney shows no positivity in cells in tubules as expected.![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]](https://resources.rndsystems.com/images/products/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0014.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]")
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506]
Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.Applications for SPACA1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SPACA1
Alternate Names
MGC32952, SAMP32, sperm acrosomal membrane-associated protein 32, sperm acrosome associated 1, sperm acrosome membrane-associated protein 1
Gene Symbol
SPACA1
UniProt
Additional SPACA1 Products
Product Documents for SPACA1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SPACA1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SPACA1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SPACA1 Antibody - BSA Free and earn rewards!
Have you used SPACA1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...