SPG21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09475

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPG21 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPG21 (NP_057714). Peptide sequence IPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SPG21 Antibody - BSA Free

Western Blot: SPG21 Antibody [NBP3-09475]

Western Blot: SPG21 Antibody [NBP3-09475]

Western Blot: SPG21 Antibody [NBP3-09475] - Western blot analysis of SPG21 in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for SPG21 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPG21

SPG21 is encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

Acid cluster protein 33, ACP33Spastic paraplegia 21 protein, GL010, MASPARDIN, MASTBM-019, spastic paraplegia 21 (autosomal recessive, Mast syndrome), Spastic paraplegia 21 autosomal recessive Mast syndrome protein

Gene Symbol

SPG21

Additional SPG21 Products

Product Documents for SPG21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPG21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPG21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPG21 Antibody - BSA Free and earn rewards!

Have you used SPG21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies