Sphingomyelin synthase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09337

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Sphingomyelin synthase 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Sphingomyelin synthase 1 (NP_659041). Peptide sequence LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Sphingomyelin synthase 1 Antibody - BSA Free

Western Blot: Sphingomyelin synthase 1 Antibody [NBP3-09337]

Western Blot: Sphingomyelin synthase 1 Antibody [NBP3-09337]

Western Blot: Sphingomyelin synthase 1 Antibody [NBP3-09337] - Western blot analysis of Sphingomyelin synthase 1 in Mouse Muscle as a positive control. Antibody dilution at 1.0 ug/ml

Applications for Sphingomyelin synthase 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sphingomyelin synthase 1

The protein encoded by the Sphingomyelin synthase 1 gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. (provided by RefSeq)

Long Name

Phosphatidylcholine:ceramide cholinephosphotransferase 1

Alternate Names

EC 2.7.8.27, MOB, Protein Mob, SGMS1, SMS1, TMEM23

Gene Symbol

SGMS1

Additional Sphingomyelin synthase 1 Products

Product Documents for Sphingomyelin synthase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sphingomyelin synthase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sphingomyelin synthase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sphingomyelin synthase 1 Antibody - BSA Free and earn rewards!

Have you used Sphingomyelin synthase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies