SPIN2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83592

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPIN2A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SPIN2A. Peptide sequence: NMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKGTVLDQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPIN2A Antibody - BSA Free

Western Blot: SPIN2A Antibody [NBP2-83592]

Western Blot: SPIN2A Antibody [NBP2-83592]

Western Blot: SPIN2A Antibody [NBP2-83592] - Host: Rabbit. Target Name: SPIN2A. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SPIN2A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPIN2A

The SPIN2A gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. (provided by RefSeq)

Alternate Names

centromeric spin2 copy, DXF34dJ323P24.1, MGC88670, Protein DXF34, RP3-323P24.2, SPIN2, SPIN-2, SPIN-2A, spindlin family, member 2, spindlin family, member 2A, spindlin homolog 2, spindlin-2A, spindlin-like protein 2, Spindlin-like protein 2A

Gene Symbol

SPIN2A

Additional SPIN2A Products

Product Documents for SPIN2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPIN2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPIN2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPIN2A Antibody - BSA Free and earn rewards!

Have you used SPIN2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies