SPRED1 (Sprouty-related protein with an EVH1 domain-1) is a 55 kDa member of the SPRED family of regulatory molecules. It inhibits mitogenic signaling by blocking Ras activation of Raf, and disrupts actin stress fiber formation by binding TESK1. Human SPRED1 is 444 amino acids (aa) in length. It contains an N-terminal WH1/EVH1 domain that is involved in ERK inhibition (aa 6 - 123), a central KBD domain that binds to the SCFR (aa 233 - 285), and a C-terminal Cys-rich/Sprouty-related domain that mediates homo- and heterodimerization with SPRED2, binding to TESK1, and undergoes palmitoylation for membrane localization (aa 334 - 442). There is one splice variant that shows a nine Lys substitution for aa 269 - 444.
SPRED1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-57368
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (92%). Backed by our 100% Guarantee.
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit SPRED1 Antibody - BSA Free (NBP2-57368) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for SPRED1 Antibody - BSA Free
Western Blot: SPRED1 Antibody [NBP2-57368]
Western Blot: SPRED1 Antibody [NBP2-57368] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.Immunocytochemistry/ Immunofluorescence: SPRED1 Antibody [NBP2-57368]
Immunocytochemistry/Immunofluorescence: SPRED1 Antibody [NBP2-57368] - Staining of human cell line U-2 OS shows localization to nucleus.Applications for SPRED1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SPRED1
Long Name
Sprouty-related with an EVH1 Domain Containing-1
Alternate Names
NFLS
Gene Symbol
SPRED1
Additional SPRED1 Products
Product Documents for SPRED1 Antibody - BSA Free
Product Specific Notices for SPRED1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SPRED1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SPRED1 Antibody - BSA Free and earn rewards!
Have you used SPRED1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...