SPSB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86827

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPSB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SPSB1. Peptide sequence: RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPSB1 Antibody - BSA Free

Western Blot: SPSB1 Antibody [NBP2-86827]

Western Blot: SPSB1 Antibody [NBP2-86827]

Western Blot: SPSB1 Antibody [NBP2-86827] - WB Suggested Anti-SPSB1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung
Western Blot: SPSB1 Antibody [NBP2-86827]

Western Blot: SPSB1 Antibody [NBP2-86827]

Western Blot: SPSB1 Antibody [NBP2-86827] - Host: Rabbit. Target: SPSB1. Positive control (+): Human Liver (LI). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

Applications for SPSB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPSB1

Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Alternate Names

novel SPRY domain containing protein, splA/ryanodine receptor domain and SOCS box containing 1, SPRY domain-containing SOCS box protein 1, SSB-1SPRY domain-containing SOCS box protein SSB-1, SSB1SPSB

Gene Symbol

SPSB1

Additional SPSB1 Products

Product Documents for SPSB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPSB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPSB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPSB1 Antibody - BSA Free and earn rewards!

Have you used SPSB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies