SPT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85816

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPT3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SPT3. Peptide sequence: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPT3 Antibody - BSA Free

Western Blot: SPT3 Antibody [NBP2-85816]

Western Blot: SPT3 Antibody [NBP2-85816]

Western Blot: SPT3 Antibody [NBP2-85816] - WB Suggested Anti-SUPT3H Antibody Titration: 0.4ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysateSUPT3H is supported by BioGPS gene expression data to be expressed in HepG2
Immunohistochemistry-Paraffin: SPT3 Antibody [NBP2-85816]

Immunohistochemistry-Paraffin: SPT3 Antibody [NBP2-85816]

Immunohistochemistry-Paraffin: SPT3 Antibody [NBP2-85816] - Rabbit Anti-SUPT3H Antibody. Paraffin Embedded Tissue: Human Liver. Cellular Data: Hepatocytes. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for SPT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPT3

The transcription of many RNA polymerase II-dependent genes requires Spt3, a member of the S. cerevisiae SAGA complex. Transcription from delta sequences, the long terminal repeats that flank yeast Ty elements, requires the yeast SPT3 gene. Spt3 and Spt20 work together to recruit TATA-box binding protein (TBP) to the core promoter allowing TBP to bind to SAGA-dependent promoters. Null mutations in the Spt3 gene cause defects in sporulation, diploid filamentous growth, and haploid invasive growth, indicating that Spt3 has an important role in both mating and development pathways in yeast. At the promoters of some genes including yeast HO, HIS3 and TRP3 genes, Spt3 inhibits binding of TBP, resulting in reduced transcription. This repressive effect of Spt3 can be overcome by another member of the SAGA complex, GCN5, which promotes the formation of a TBP/TFIIA complex by histone acetylation.

Alternate Names

SPT3-like protein, SPT3SPT3L, suppressor of Ty (S.cerevisiae) 3 homolog, suppressor of Ty 3 homolog (S. cerevisiae), transcription initiation protein SPT3 homolog

Gene Symbol

SUPT3H

Additional SPT3 Products

Product Documents for SPT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPT3 Antibody - BSA Free and earn rewards!

Have you used SPT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies