SRD5A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69492

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SRD5A2(steroid-5-alpha-reductase, alpha polypeptide 2) The peptide sequence was selected from the N terminal of SRD5A2. Peptide sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SRD5A2 Antibody - BSA Free

Western Blot: SRD5A2 Antibody [NBP1-69492]

Western Blot: SRD5A2 Antibody [NBP1-69492]

Western Blot: SRD5A2 Antibody [NBP1-69492] - This Anti-SRD5A2 antibody was used in Western Blot of THP-1 cell lysate at a concentration of 1ug/ml.
Immunohistochemistry: SRD5A2 Antibody [NBP1-69492]

Immunohistochemistry: SRD5A2 Antibody [NBP1-69492]

Immunohistochemistry: SRD5A2 Antibody [NBP1-69492] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: SRD5A2 Blue: Nucleus Gene name: SRD5A2 Submitted by: Jonathan Bertin, Endoceutics Inc.
Immunohistochemistry: SRD5A2 Antibody [NBP1-69492]

Immunohistochemistry: SRD5A2 Antibody [NBP1-69492]

Immunohistochemistry: SRD5A2 Antibody [NBP1-69492] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: SRD5A2 Blue: Nucleus Gene name: SRD5A2 Submitted by: Jonathan Bertin, Endoceutics Inc.

Applications for SRD5A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRD5A2

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride.

Long Name

3-oxo-5-alpha-steroid 4-dehydrogenase 2

Alternate Names

5 alpha-SR2, S5AR 2, SR type 2

Gene Symbol

SRD5A2

UniProt

Additional SRD5A2 Products

Product Documents for SRD5A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRD5A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRD5A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRD5A2 Antibody - BSA Free and earn rewards!

Have you used SRD5A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...