SRp55 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57112

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SRp55 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS6(splicing factor, arginine/serine-rich 6) The peptide sequence was selected from the middle region of SFRS6. Peptide sequence KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SRp55 Antibody - BSA Free

Western Blot: SRp55 Antibody [NBP1-57112]

Western Blot: SRp55 Antibody [NBP1-57112]

Western Blot: SRp55 Antibody [NBP1-57112] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for SRp55 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRp55

SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

B52, FLJ08061, pre-mRNA splicing factor SRP55, Pre-mRNA-splicing factor SRP55, serine/arginine-rich splicing factor 6, SFRS6, Splicing factor, arginine/serine-rich 6MGC5045, splicing factor, arginine/serine-rich, 55 kDa, SR splicing factor 6, SRP55arginine/serine-rich splicing factor 6

Gene Symbol

SRSF6

UniProt

Q13247 (Human)

Additional SRp55 Products

Product Documents for SRp55 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SRp55 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRp55 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRp55 Antibody - BSA Free and earn rewards!

Have you used SRp55 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies