SS18L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56614

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SS18L1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SS18L1(synovial sarcoma translocation gene on chromosome 18-like 1) The peptide sequence was selected from the middle region of SS18L1. Peptide sequence EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SS18L1 Antibody - BSA Free

Western Blot: SS18L1 Antibody [NBP1-56614]

Western Blot: SS18L1 Antibody [NBP1-56614]

Western Blot: SS18L1 Antibody [NBP1-56614] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SS18L1 Antibody [NBP1-56614]

Western Blot: SS18L1 Antibody [NBP1-56614]

Western Blot: SS18L1 Antibody [NBP1-56614] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Jurkat cell lysatesS18L1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Applications for SS18L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SS18L1

The specific functin of this protein remains unknown.Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.[supplied by OMIM].

Alternate Names

calcium-responsive transactivator, CRESTMGC78386, KIAA0693MGC26711, LP2261, SS18-like protein 1, synovial sarcoma translocation gene on chromosome 18-like 1, SYT homolog 1

Gene Symbol

SS18L1

UniProt

O75177 (Human)

Additional SS18L1 Products

Product Documents for SS18L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SS18L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SS18L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SS18L1 Antibody - BSA Free and earn rewards!

Have you used SS18L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies