SSR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80667

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SSR3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SSR3 Antibody - BSA Free

Western Blot: SSR3 Antibody [NBP1-80667]

Western Blot: SSR3 Antibody [NBP1-80667]

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: SSR3 Antibody [NBP1-80667]

Western Blot: SSR3 Antibody [NBP1-80667]

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667]

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human lymph node shows strong cytoplasmic postitivity in non-geminal center cells.

Applications for SSR3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-80667 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SSR3

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. The protein encoded by this gene is the gamma subunit and is predicted to span the membrane four times. (provided by RefSeq)

Alternate Names

signal sequence receptor, gamma (translocon-associated protein gamma), SSR gamma, SSR-gamma, translocon-associated protein gamma subunit, translocon-associated protein subunit gamma, TRAP-complex gamma subunit, TRAP-gamma, TRAPGSignal sequence receptor subunit gamma

Entrez Gene IDs

6747 (Human)

Gene Symbol

SSR3

Additional SSR3 Products

Product Documents for SSR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SSR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SSR3 Antibody - BSA Free

Customer Reviews for SSR3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SSR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Marie-estelle LOSFELD
    Application: Western Blot
    Sample Tested: human dermal fibroblasts
    Species: Human
    Verified Customer | Posted 02/27/2014
    SSR3 detection in fibroblasts
    SSR3 Antibody - BSA Free NBP1-80667

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies