SSRP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85823

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSRP1. Peptide sequence: SSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SSRP1 Antibody - BSA Free

Western Blot: SSRP1 Antibody [NBP2-85823]

Western Blot: SSRP1 Antibody [NBP2-85823]

Western Blot: SSRP1 Antibody [NBP2-85823] - WB Suggested Anti-SSRP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysateSSRP1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Applications for SSRP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SSRP1

SSRP1 is a nuclear protein and a component of the FACT complex (facilitates chromatin transcription). The FACT complex is composed of the SUPT16H (FACT140) and the SSRP1 FACTp80 proteins. This complex interacts with nucleosomes and histone H2A/H2B dimers to promote nucleosome disassembly and allow transcription elongation. This protein interacts with dsDNA. The SSRP1 protein has been shown to be modified by cisplatin and may protect DNA from repair and block DNA replication. The 10D7 monoclonal antibody recognizes the human SSRP1 protein and has been shown to be useful for Western blotting.

Alternate Names

Chromatin-specific transcription elongation factor 80 kDa subunit, cisplatin-DNA SSRP, facilitates chromatin remodeling 80 kDa subunit, Facilitates chromatin transcription complex 80 kDa subunit, Facilitates chromatin transcription complex subunit SSRP1, FACT, FACT complex subunit SSRP1, FACT80FACT 80 kDa subunit, FACTp80, high mobility group box, hSSRP1, Recombination signal sequence recognition protein 1, structure specific recognition protein 1, Structure-specific recognition protein 1, T160

Gene Symbol

SSRP1

Additional SSRP1 Products

Product Documents for SSRP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SSRP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SSRP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SSRP1 Antibody - BSA Free and earn rewards!

Have you used SSRP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...