StAR Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86992

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for StAR Antibody - BSA Free

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human adrenal gland, kidney, lymph node and testis using Anti-STAR antibody NBP1-86992 (A) shows similar protein distribution across tissues to independent antibody NBP1-86993 (B).
StAR Antibody - BSA Free Immunohistochemistry-Paraffin: StAR Antibody - BSA Free [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody - BSA Free [NBP1-86992]

Analysis in human adrenal gland and pancreas tissues using Anti-STAR antibody. Corresponding STAR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human lymph node.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human testis.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992]

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human kidney.

Applications for StAR Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: StAR

StAR is encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

Alternate Names

cholesterol trafficker, mitochondrial steroid acute regulatory protein, StAR, StARD1, STARD1StAR-related lipid transfer (START) domain containing 1, START domain containing 1, START domain-containing protein 1, steroid acute regulatory protein, steroidogenic acute regulator, steroidogenic acute regulatory protein, steroidogenic acute regulatory protein, mitochondrial

Gene Symbol

STAR

Additional StAR Products

Product Documents for StAR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for StAR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for StAR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review StAR Antibody - BSA Free and earn rewards!

Have you used StAR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...