START domain containing 7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88369

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human START domain containing 7. Peptide sequence: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for START domain containing 7 Antibody - BSA Free

Western Blot: START domain containing 7 Antibody [NBP2-88369]

Western Blot: START domain containing 7 Antibody [NBP2-88369]

Western Blot: START domain containing 7 Antibody [NBP2-88369] - WB Suggested Anti-STARD7 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole Cell

Applications for START domain containing 7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: START domain containing 7

Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Two alternatively spliced transcript variants that encode an identical protein have been reported.

Alternate Names

Gestational trophoblastic tumor protein 1, GTT1stAR-related lipid transfer protein 7, mitochondrial, StARD7, StAR-related lipid transfer (START) domain containing 7, START domain containing 7, START domain-containing protein 7

Gene Symbol

STARD7

Additional START domain containing 7 Products

Product Documents for START domain containing 7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for START domain containing 7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for START domain containing 7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review START domain containing 7 Antibody - BSA Free and earn rewards!

Have you used START domain containing 7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...