Recombinant Human STEAP2 GST (N-Term) Protein
Novus Biologicals | Catalog # H00261729-Q01
Select the "Bulk Orders" button to request additional sizes or formulations.
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: ESISMMGSPKSLSETVLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTS
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human STEAP2 GST (N-Term) Protein
Formulation, Preparation, and Storage
H00261729-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: STEAP2
Long Name
Alternate Names
Gene Symbol
Additional STEAP2 Products
Product Documents for Recombinant Human STEAP2 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human STEAP2 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Recombinant Human STEAP2 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human STEAP2 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human STEAP2 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human STEAP2 GST (N-Term) Protein
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.