Steroid sulfatase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69686

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Steroid sulfatase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to STS(steroid sulfatase (microsomal), isozyme S) The peptide sequence was selected from the middle region of STS. Peptide sequence EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Steroid sulfatase Antibody - BSA Free

Western Blot: Steroid sulfatase Antibody [NBP1-69686]

Western Blot: Steroid sulfatase Antibody [NBP1-69686]

Western Blot: Steroid sulfatase Antibody [NBP1-69686] - This Anti-STS antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.

Applications for Steroid sulfatase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Steroid sulfatase

Steroid sulfatase catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Steryl-sulfatase

Alternate Names

ARSC1, Arylsulfatase C, ASC, EC 3.1.6.2, Estrone sulfatase, STS

Gene Symbol

STS

UniProt

P08842 (Human)

Additional Steroid sulfatase Products

Product Documents for Steroid sulfatase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Steroid sulfatase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Steroid sulfatase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Steroid sulfatase Antibody - BSA Free and earn rewards!

Have you used Steroid sulfatase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies