Sterol carrier protein 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55214

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Sterol carrier protein 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SCP2(sterol carrier protein 2) The peptide sequence was selected from the middle region of SCP2 (NP_001007099). Peptide sequence NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Sterol carrier protein 2 Antibody - BSA Free

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214]

Western Blot: Sterol carrier protein 2 Antibody [NBP1-55214] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for Sterol carrier protein 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sterol carrier protein 2

SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Alternate Names

DKFZp686C12188, DKFZp686D11188, NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-chi, SCPX, SCP-X, sterol carrier protein 2EC 2.3.1.176, Sterol carrier protein X

Entrez Gene IDs

6342 (Human)

Gene Symbol

SCP2

UniProt

Q6NXF4 (Human)

Additional Sterol carrier protein 2 Products

Product Documents for Sterol carrier protein 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Sterol carrier protein 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sterol carrier protein 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sterol carrier protein 2 Antibody - BSA Free and earn rewards!

Have you used Sterol carrier protein 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies