SUV39H2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38202

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Chromatin Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SUV39H2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 141-350 of human SUV39H2 (NP_001180354.1).

Sequence:
CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SUV39H2 Antibody - BSA Free

SUV39H2 Antibody

Chromatin Immunoprecipitation: SUV39H2 Antibody [NBP3-38202] -

Chromatin Immunoprecipitation: SUV39H2 Antibody [NBP3-38202] - Chromatin immunoprecipitation analysis of extracts of 293T cell line, using SUV39H2 antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
SUV39H2 Antibody

Western Blot: SUV39H2 Antibody [NBP3-38202] -

Western Blot: SUV39H2 Antibody [NBP3-38202] - Western blot analysis of various lysates using SUV39H2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for SUV39H2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation

5ug antibody for 10ug-15ug of Chromatin

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUV39H2

Suppressor of variegation 3-9 homolog 2 (Drosophila) is a histone lysine N-methyltransferase activity (H3-K9 specific). This protein contains a SET domain (HMTase activity) and binds chromatin.

Alternate Names

FLJ23414Histone H3-K9 methyltransferase 2, H3-K9-HMTase 2, histone-lysine N-methyltransferase SUV39H2, KMT1BEC 2.1.1.43, Lysine N-methyltransferase 1B, Su(var)3-9 homolog 2, Suppressor of variegation 3-9 homolog 2, suppressor of variegation 3-9 homolog 2 (Drosophila)

Gene Symbol

SUV39H2

Additional SUV39H2 Products

Product Documents for SUV39H2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SUV39H2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUV39H2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUV39H2 Antibody - BSA Free and earn rewards!

Have you used SUV39H2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies