Synaptogyrin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87530

Novus Biologicals
Discontinued Product
NBP1-87530 has been discontinued. View all Synaptogyrin 4 products.

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synaptogyrin 4 Antibody - BSA Free

Western Blot: Synaptogyrin 4 Antibody [NBP1-87530]

Western Blot: Synaptogyrin 4 Antibody [NBP1-87530]

Western Blot: Synaptogyrin 4 Antibody [NBP1-87530] - Analysis in control (vector only transfected HEK293T lysate) and SYNGR4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining in human testis and endometrium tissues using anti-SYNGR4 antibody. Corresponding SYNGR4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human small intestine shows distinct membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530]

Immunohistochemistry-Paraffin: Synaptogyrin 4 Antibody [NBP1-87530] - Staining of human testis shows high expression.

Applications for Synaptogyrin 4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
HIER pH6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptogyrin 4

Synaptogyrin 4 encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.

Alternate Names

MGC125805, synaptogyrin 4, synaptogyrin-4

Gene Symbol

SYNGR4

Additional Synaptogyrin 4 Products

Product Documents for Synaptogyrin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Synaptogyrin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptogyrin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptogyrin 4 Antibody - BSA Free and earn rewards!

Have you used Synaptogyrin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...