Syntaxin 4 Antibody (8F3P7)

Novus Biologicals | Catalog # NBP3-16629

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8F3P7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)). QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syntaxin 4 Antibody (8F3P7)

Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629] - Western blot analysis of extracts of various cell lines, using Syntaxin 4 Rabbit mAb (NBP3-16629) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Western Blot: Syntaxin 4 Antibody (8F3P7) [NBP3-16629] - Western blot analysis of extracts of Rat brain, using Syntaxin 4 Rabbit mAb (NBP3-16629) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Immunocytochemistry/ Immunofluorescence: Syntaxin 4 Antibody (8F3P7) [NBP3-16629]

Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody (8F3P7) [NBP3-16629] - Immunofluorescence analysis of NIH-3T3 cells using Syntaxin 4 Rabbit mAb (NBP3-16629) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Syntaxin 4 Antibody (8F3P7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Syntaxin 4

Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes. May also play a role in docking of synaptic vesicles at presynaptic active zones

Alternate Names

NY-REN-31, p35-2, STX4

Gene Symbol

STX4

Additional Syntaxin 4 Products

Product Documents for Syntaxin 4 Antibody (8F3P7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Syntaxin 4 Antibody (8F3P7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Syntaxin 4 Antibody (8F3P7)

There are currently no reviews for this product. Be the first to review Syntaxin 4 Antibody (8F3P7) and earn rewards!

Have you used Syntaxin 4 Antibody (8F3P7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...