Syntaxin Binding Protein 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92470

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Syntaxin Binding Protein 4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALHSRIHLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syntaxin Binding Protein 4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Syntaxin Binding Protein 4 Antibody [NBP1-92470]

Immunocytochemistry/ Immunofluorescence: Syntaxin Binding Protein 4 Antibody [NBP1-92470]

Immunocytochemistry/Immunofluorescence: Syntaxin Binding Protein 4 Antibody [NBP1-92470] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Syntaxin Binding Protein 4 Antibody [NBP1-92470]

Immunohistochemistry-Paraffin: Syntaxin Binding Protein 4 Antibody [NBP1-92470]

Immunohistochemistry-Paraffin: Syntaxin Binding Protein 4 Antibody [NBP1-92470] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Syntaxin Binding Protein 4 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Syntaxin Binding Protein 4 Antibody - BSA Free [NBP1-92470]

Immunocytochemistry/ Immunofluorescence: Syntaxin Binding Protein 4 Antibody - BSA Free [NBP1-92470]

Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Applications for Syntaxin Binding Protein 4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syntaxin Binding Protein 4

Synip (Syntaxin 4-Interacting protein) specifically binds to Syntaxin 4 and is uniquely expressed in muscle and adipose tissue. The binding interaction of Synip with syntaxin 4 is regulated by insulin, which also induces dissociation of the Synip-syntaxin 4 complex. Synip plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane and functions as a positive regulator of insulin-stimulated GLUT4 translocation. Synip also competes with VAMP2 but Not SNAP23 for binding to Syntaxin 4 (1-3).

Alternate Names

FLJ16496, MGC50337, STX4-interacting protein, SynipMGC149829, syntaxin 4 interacting protein, Syntaxin 4-interacting protein, syntaxin binding protein 4, syntaxin-binding protein 4

Gene Symbol

STXBP4

Additional Syntaxin Binding Protein 4 Products

Product Documents for Syntaxin Binding Protein 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntaxin Binding Protein 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Syntaxin Binding Protein 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Syntaxin Binding Protein 4 Antibody - BSA Free and earn rewards!

Have you used Syntaxin Binding Protein 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies